PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06421.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 287aa    MW: 32426.3 Da    PI: 10.6721
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06421.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3331.1e-105475599
                             ETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3 55 ksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                             +++r++lt+GW+ Fv+a++L +gD+v+F   ++++ +l+++++r+
  Sme2.5_06421.1_g00002.1  5 QPKRHLLTTGWSVFVSAKRLVAGDSVLFI--WNEKNQLLLGIRRA 47
                             6789*************************..8889999***9996 PP

2Auxin_resp118.36.4e-3972155183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aahaa+t+s F+v++nPras+seFv++++k+ ka++ ++vsvGmRf+m fete+ss rr++Gt++g+ dldpvrW nS+Wrs+k
  Sme2.5_06421.1_g00002.1  72 AAHAAATNSCFTVFFNPRASPSEFVIPLSKYIKAVYhTRVSVGMRFRMLFETEESSVRRYMGTITGIGDLDPVRWANSHWRSVK 155
                              79*********************************9789******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.728148IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-13475IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.6E-15461IPR015300DNA-binding pseudobarrel domain
PfamPF023622.9E-8547IPR003340B3 DNA binding domain
PfamPF065072.9E-3472155IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MLPGQPKRHL LTTGWSVFVS AKRLVAGDSV LFIWNEKNQL LLGIRRAIRP QTVMPSSVLS  60
SDSMHIGLLA AAAHAAATNS CFTVFFNPRA SPSEFVIPLS KYIKAVYHTR VSVGMRFRML  120
FETEESSVRR YMGTITGIGD LDPVRWANSH WRSVKDLPSL RKMDINYKNL GASEHINPFG  180
KIPQGRVTKR AIVVAVWLTA STNTQPADRY YVIEESGSAR YGYETRYART RPHLDLHIDN  240
LLQNWSWQEE RKIPASTRAA VKRGSVEWSN PRVILGAFSM PDKENLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A4e-654155216367Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8354231e-165JN835423.1 Nicotiana tabacum auxin response factor 8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165582.11e-101PREDICTED: auxin response factor 8-like isoform X3
SwissprotA2X1A13e-88ARFF_ORYSI; Auxin response factor 6
SwissprotQ6H6V43e-88ARFF_ORYSJ; Auxin response factor 6
SwissprotQ9ZTX84e-88ARFF_ARATH; Auxin response factor 6
TrEMBLK4B5U71e-100K4B5U7_SOLLC; Auxin response factor
TrEMBLM1BLU51e-105M1BLU5_SOLTU; Auxin response factor
TrEMBLM1BLU81e-100M1BLU8_SOLTU; Auxin response factor
TrEMBLM1BLU91e-100M1BLU9_SOLTU; Auxin response factor
STRINGSolyc02g037530.2.11e-99(Solanum lycopersicum)
STRINGPGSC0003DMT4000480341e-100(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.22e-88auxin response factor 6